SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3ITK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3ITK5
Domain Number 1 Region: 1-95
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.77e-38
Family Forkhead DNA-binding domain 0.0000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3ITK5
Sequence length 322
Comment (tr|U3ITK5|U3ITK5_ANAPL) Forkhead box F1 {ECO:0000313|Ensembl:ENSAPLP00000010578} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=FOXF1 OC=Anatinae; Anas.
Sequence
QKPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECF
IKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRGFRRKCQALKPMYSMMNGLSFNHL
PDSYSFQGSAGGLSCPPPPSLSLEGGLGMMNGHLAGNVDGMGLAGHSVPHLPASSSAGDY
PHHDGSVPASPLLAGGGVMEPHSVYSSSASAWXPPERTPRLRAFLRPQAAAEKAGKNPPS
AAFREHPAPSRAQKTVPTTADTSFSPCPAGIPRYHSQSPSMCDRKEFVFSFNAMASSSMH
SAGSGSYYHQQVTKQELSPCPR
Download sequence
Identical sequences U3ITK5
ENSAPLP00000010578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]