SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3IUS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3IUS7
Domain Number 1 Region: 241-356
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.12e-34
Family UBX domain 0.00000205
Further Details:      
 
Domain Number 2 Region: 163-256
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 1.11e-32
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.00000384
Further Details:      
 
Domain Number 3 Region: 3-34
Classification Level Classification E-value
Superfamily UBA-like 0.0000107
Family TAP-C domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U3IUS7
Sequence length 358
Comment (tr|U3IUS7|U3IUS7_ANAPL) NSFL1 cofactor {ECO:0000313|Ensembl:ENSAPLP00000011000} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=NSFL1C OC=Anatinae; Anas.
Sequence
XAVAGGEEERARFFLESAGWDLQIALASFYEDGGDEDILTLPQPAPSAVSRGTAASDHRV
TSFRDLVHAQEDDDEEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVEDLFKGAKEHGAV
AVDRTAKSSGESSKPKPFAGGGYRLGATPEEESAYVAGERRQSSVQDVHVVLKLWKSGFS
LDSGELRSYQDPSNAQFLDDIRRGEVPAELRRLARGGQVNLDMEDHRDEEYVKPKSVFKA
FTGEGQKLGSTAPQVLGTSSPAQQAENEAKASSAITIDESEPVTNIQIRLADGGRLVQKF
NHNHRIRDIRLFIVDARPAMAATSFVLMTTFPNKELTDENQTLKEANLLNAVIVQRLT
Download sequence
Identical sequences U3IUS7
ENSAPLP00000011000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]