SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3IV32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3IV32
Domain Number 1 Region: 243-324
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.62e-29
Family Forkhead DNA-binding domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U3IV32
Sequence length 782
Comment (tr|U3IV32|U3IV32_ANAPL) Forkhead box M1 {ECO:0000313|Ensembl:ENSAPLP00000011105} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=FOXM1 OC=Anatinae; Anas.
Sequence
MRTSPRRPLILKRRKLAIPQEDAPSTSARDEHDGQGQKTSKQEHSQEDQHDSQGRDKTDS
GLQKFPAGIKIINHPTMPNTQVVAIPTNADIQSIIEALTAKGKECGNNGPNKFILISSGG
TSCSSGSGLSQHLPSEKPGAAIKAADGQTPGLAGGTTTWHSGVDSVVAQEQESTSSGETM
SSVLDNSLTNIQWLGKMRTDGLSPCSVKQDMEKENQIPLQEKIKTEEDSTAVAISWQDSI
SERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHVAKPGWKNSIRHNLSLHD
MFVRETSANGKISFWTIHPDANRCLTLDQVFKPLDLGSPTSPEHSESQQKRHVPDLQKNV
GSSSKTEPQNARRKMKPLLPRINSYLVPIQFPVSQPLVLQPSMKVPLSMAQGASLNSSET
FQCNKRVRIAPKMSLSMDESSSLPVAIVKEESQCDEGLFSQTHSLKESSSQPGEELASFP
ETRCIKEEEVSQLDDWLSPFASTLTVKEEPALFLPVSTATENKHFTALKSPSKSFSDTLV
IKRRERREMSRSRRKQQLALPCSEEPVLILPESNDFDPFRLGADLPFLQESQAPENVSQL
SCLQGEEGPFKTPVKEMFNKLPVSSTPSKVPANATPPLGGLDPWKSASLAKESNELDFSP
VRTLQLPFTPLQENQDLLGFNSTPLKNPLFESPRELLNADSSDMVHGPLTSSPAFTNEST
KQLSVELPASGFTENRSLMEGLILDTMNDSLSKILLDISFPGLEDENLGTDISWSQLIPE
LK
Download sequence
Identical sequences U3IV32
ENSAPLP00000011105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]