SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3IXP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3IXP2
Domain Number 1 Region: 634-891
Classification Level Classification E-value
Superfamily YWTD domain 7.19e-56
Family YWTD domain 0.00000362
Further Details:      
 
Domain Number 2 Region: 21-280
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-54
Family YWTD domain 0.00000158
Further Details:      
 
Domain Number 3 Region: 331-566
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-49
Family YWTD domain 0.00000361
Further Details:      
 
Domain Number 4 Region: 942-1202
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-40
Family YWTD domain 0.0000332
Further Details:      
 
Domain Number 5 Region: 1333-1371
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000969
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 893-935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000112
Family EGF-type module 0.018
Further Details:      
 
Domain Number 7 Region: 1254-1294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 590-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000344
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 9 Region: 1295-1331
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 283-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000317
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1212-1265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000642
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3IXP2
Sequence length 1620
Comment (tr|U3IXP2|U3IXP2_ANAPL) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=LRP6 OC=Anatinae; Anas.
Sequence
FGSEIRALSQVSLCIIFEAAPLLLYANRRDLRLVDAAHGKENATVIVGGLEDAAAVDFVF
LKGLIYWSDVSEEAIKRTEFNKSGSVQNVVISGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPARGFMYWTDWGEVPKIERAGMDGSSRSIIVNTD
IYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGSHRQAVVKGSLPHPFALTLFGDTLYWT
DWNTHSILACSKYSGEDLREIHSNIFSPMDIHAFSQKRQPNATNPCGINNGGCSHLCLMS
PTKPSYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLPLEDIR
HAIAIDFDPLEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RIVLVNTSLGWPNGLALDYEESKIYWGDAKTDKIEVMNADGTGRRVLVEDKLPHIFGFTL
LGDYVYWTDWQRRSIERVQKRTAEREIIIDQLPDLMGLKATNVRQIIGLGTNPCAEDNGG
CSHLCLYRPQGLRCACPIGLELINDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPL
TGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKN
LYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAM
DGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLETGLDREIIADDLPHPF
GLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASS
NGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSVHQAPTTFLLFSQKNAINRMVIDEQQ
SPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNIIRKAQEDGSQSLTVVTSPVPNQNLD
MQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSMGVVLKGDQDRPRAIVVNPEKGYMYF
TNLQERSPKIERAALDGTEREVLFFSGLSKPIALAIDSQLGKLFWADSDLRRIESSDLSA
GANRIVLEDSNILQPVGLTVFENWLYWIDRQQQMIEKIDMTGREGRTKVQARIAQLSDIH
AVKELNIQEYRQHPCSQDNGGCSHICIVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPQ
QFTCFTGEIDCIPVAWRCDGFTECEDHSDEKNCPVCSDTQFQCESGQCIDSALRCNGEAN
CQDNSDEKNCEVLCLTDQFRCASGQCIGKSKKCDHNLDCSDSSDEQGCYTTEEPAPQPNN
TIGSIIGVILTVFVVGAMYFICQRVLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSL
SGSLPGMSRGKSVISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPA
TERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRVTAATA
KGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences U3IXP2
ENSAPLP00000012018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]