SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3IYD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3IYD2
Domain Number 1 Region: 104-202
Classification Level Classification E-value
Superfamily E2F-DP heterodimerization region 5.75e-36
Family E2F dimerization segment 0.00033
Further Details:      
 
Domain Number 2 Region: 27-91
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.9e-17
Family Cell cycle transcription factor e2f-dp 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3IYD2
Sequence length 231
Comment (tr|U3IYD2|U3IYD2_ANAPL) E2F transcription factor 6 {ECO:0000313|Ensembl:ENSAPLP00000012258} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=E2F6 OC=Anatinae; Anas.
Sequence
LQPPMLNLNLDGDVQVVRKTLKAKRPRFDASLVYLTRKFMDLVKRAPDGVLDLNEVATTL
GVRKRRVYDITNVLDGIHLIQKRSKNLIQWVGSNLDQVVGKAAEQQNLKDELSDLSAMEE
ALDELIKDCAHQLFDLTDDKENAKYPYVTYQDIRSIQAFQKQIVIAIKAPEETKLEIPIP
KEDCIEVHVKSTKGPIDVYLCEVEQDKPGAKTFENMNTVKSETEPSVPPGE
Download sequence
Identical sequences U3IYD2
ENSAPLP00000012258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]