SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3IZ09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3IZ09
Domain Number 1 Region: 31-137
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.52e-35
Family MBT repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 346-447
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.05e-30
Family MBT repeat 0.00054
Further Details:      
 
Domain Number 3 Region: 256-363
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.52e-30
Family MBT repeat 0.00075
Further Details:      
 
Domain Number 4 Region: 148-263
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.32e-27
Family MBT repeat 0.00000109
Further Details:      
 
Domain Number 5 Region: 841-913
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.8e-17
Family SAM (sterile alpha motif) domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3IZ09
Sequence length 918
Comment (tr|U3IZ09|U3IZ09_ANAPL) Scm like with four mbt domains 2 {ECO:0000313|Ensembl:ENSAPLP00000012485} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=SFMBT2 OC=Anatinae; Anas.
Sequence
ADEGSSIEDADFNWDEFLEETGASAAPHTSFKHVEISLQSSFQPGMKLEVANKSNPDTYW
VATIITTCGQLLLLRYCGYGDDRRADFWCDVMTADLHPVGWCTQNNKVLMPPDAIKEKYV
DWTEFLIHDLTGARTAPANLLEGPLRGKNPVDLITVDSLIELQDSQNPFQYWIVSVVENV
GGRLRLRYVGLEETESYDQWLFYLDCRLRPVGWCQENKYRMDPPADIYSLKTVSEWKCAL
EKSLTDAANFPLPMEVFKDHADLRSHFFTVGMKLEAVNMREPFHICPASVTKVFNNHYLQ
VTIDDLRPEPSKISMLCHADSLGILPIQWCLKNGVNLTPPKGYSGQDFDWADYQKQCGAE
AAPHQCFRNTSFSRGFTKNMKLEAVNPRNPAEICVASITSVKGRLMWLHLEGLQMPSPEY
IVDVESMDIFPVGWCEANAYNLTPPHKAVLRRKRRIAVVQPEKQLPSTVPVEKIPHDLCP
VPQPDTTAGTINGRYCCPQLYINHRCFSGPYLNKGRIAELPQSVGPGKCVLVLKEVLSMV
INAAYKPGSVLRELQLVEDPQWNFQEETLKAKYRGKTYRATVKIVRTSDQVADFCRRVCA
KLECCPNLFSPVLVAEVCPENCSIHTKTKYTYYYGKRKKIIKPPIGENNNMKSGHVKPAR
RRKRRKSIFVQKKRRSSAVDVNAAGSGEVRIALGYISKFPSLLPPHALLHLIFEGLISNL
PPTLSDKTPRNLLNVSCQESEDDEPDAMEDETGSEETSSELRDDQTDTSSAEVPSTRPRR
AVTLRSSTESDRPPPTERARRSRKPQPLSFGEAEKCTQVKEVSVPASSQEIKHEEEEKLV
LDSNPLEWTVTDVVRFIKLTDCAPLAKIFQEQDIDGQALLLLTLPTVQECMELKLGPAIK
LCHQIERVKVAFYAQYAN
Download sequence
Identical sequences U3IZ09
ENSAPLP00000012485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]