SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3J1G2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3J1G2
Domain Number 1 Region: 66-144
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.99e-36
Family Forkhead DNA-binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3J1G2
Sequence length 544
Comment (tr|U3J1G2|U3J1G2_ANAPL) Forkhead box J2 {ECO:0000313|Ensembl:ENSAPLP00000013339} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=FOXJ2 OC=Anatinae; Anas.
Sequence
MASDLESSLTSIDWLPQLTLRATIEKLGGSSQAGPPGAARKCPPGSPTDPNATLSKDEAA
VHQDGKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYYKNAGIGWKNSIRHNLSL
NKCFRKVPRPRDDPGKGSYWTIDTCPDISRKRRHPPDDDIPQDSPEQEASKSPRGAVPVS
TEASLPSEATPQLSLQSTAPIANYSQQAAGPVDVASTVAGGQGREGADVPPPLYSANHDF
KFSYSEINFQDLSWSFRNLYKSMLEKSSSSQHGFSSLLGDMQPSNHNYYMYQQQQQQQGP
SAVGAAPPLHTPTPDGCPSQGGKQQGGESYVPPPVMSMHPPPMQHGGYHQHQQHHPHSHP
QQQPHQHQQQQQSQASINNAGFAFPDWCSNIDSLKESFKMVNRLNWSSIEHSQFSELMES
LRQAERKNWTLDQHHIANLCDSLNHFLTQTGQLPHLVGPQQPPRISDSCALNSGKQEQSM
NQVNSYGQPQPPHLFSGPSPMYQISTQDSPGYNRPAHHLVPRPPGPPPGANEEIPDDFDW
DLIT
Download sequence
Identical sequences U3J1G2
ENSAPLP00000013339 XP_005012469.1.99704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]