SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3J2A5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3J2A5
Domain Number 1 Region: 515-647
Classification Level Classification E-value
Superfamily PH domain-like 2.44e-38
Family Pleckstrin-homology domain (PH domain) 0.0027
Further Details:      
 
Domain Number 2 Region: 180-279
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-17
Family PDZ domain 0.017
Further Details:      
 
Domain Number 3 Region: 6-60
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000751
Family SAM (sterile alpha motif) domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U3J2A5
Sequence length 1014
Comment (tr|U3J2A5|U3J2A5_ANAPL) Connector enhancer of kinase suppressor of Ras 2 {ECO:0000313|Ensembl:ENSAPLP00000013632} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=CNKSR2 OC=Anatinae; Anas.
Sequence
GLDDCLQQYIKNFEREKISGDQLLRITHQELEDLGVTRIGHQELILEAVDLLCALNYGLE
TENLKTLSHKLNASAKNLQNFITGRRRSGHYDGRTSRKLPNDFLTSVVDLIGAAKSLLAW
LDRSPFAAVTDYSVTRNNVIQLCLELTTIVQQDCTVYETENKILHVCKTLSGVCDHIISL
SSDPLVSQSAHLEVIQLTNIKPSEGLGMYIKSTYDGLHVITGTTENSPADRCKKIHAGDE
VIQVNHQTVVGWQLKNLVNALREDPSGVILTLKKRPQSMLTSAPALLKNMRWKPLALQPL
IPRSPTSSVATPSSTISTPTKRDSSALQDLYIPPPPSEPYVPRDEKGNLPCDDVGRHIVG
KPVHTGSESPNSFLDQEYRKRFNVVEEDAVLYCYEYDKGRTSGPGRRESTPTYGKLRPIS
MPVEYNWVGDYEDPNKIKRDSRRENSLLRYMSNEKIGQEDYMFQRNSKKDTGKKSKKKGD
KGNSPSHYSLLPSLQMDSLRQDVMGTPGPETTLYHTFQQSSLQQKSKKKNKAPIPGKSKR
RISCKDLGRGDCEGWLWKKKDAKSYFSQKWKKYWFVLKDTSLYWYINEEDEKAEGFISLP
EFKIDRASECRKKYAFKACHPKIKSFYFAAEHLDDMNRWLNRINMLAAGYAERERIKQEQ
DYWSESDKEEADTPSTPKQDSPPPPYDTYPRPPSMSCASPYVEPKHSRLSSTETSQSQSS
HEEFRPEAGATDXDSPVRKTASQRRSWQDLIETPLTSSGLHYLQTLPLEDSVFSEAAVVS
PEHRRQSTLPTQKCHLQDHYGPFPLVEGERMQVLNGNGGKPRSFTLPRDSGFNHCCQSLS
VGAADHQEEAQGKAAEENQEDKMKEGSICSGETAGKKIETIEEKAADSLQDLYRALEQAS
LSPLGDRRISTKLEYKKSFIKRCSDPVVNEKLHQLRILKSTLKAREGEVAIIDKVLDNPD
LTSRDFQEWKQMYLDIFWDICHSSTPRDSVNGSSEVDALLASLAHTHSYIETHV
Download sequence
Identical sequences U3J2A5
ENSAPLP00000013632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]