SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3J2J2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3J2J2
Domain Number 1 Region: 2-86
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.86e-29
Family Forkhead DNA-binding domain 0.0000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U3J2J2
Sequence length 103
Comment (tr|U3J2J2|U3J2J2_ANAPL) Uncharacterized protein {ECO:0000313|Ensembl:ENSAPLP00000013719} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN= OC=Anatinae; Anas.
Sequence
XLIAMAIRDSAGGRLTLAEINDYLMSRFPFFRGAYTGWRNSVRHNLSLNDCFVKVLRDPA
RPWGKDNYWMLNPSSEYTFADGVFRXSYPEVCSRPPLPAPGPR
Download sequence
Identical sequences U3J2J2
ENSAPLP00000013719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]