SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3J3S9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3J3S9
Domain Number 1 Region: 122-217
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.17e-40
Family Forkhead DNA-binding domain 0.0000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U3J3S9
Sequence length 388
Comment (tr|U3J3S9|U3J3S9_ANAPL) Forkhead box A2 {ECO:0000313|Ensembl:ENSAPLP00000014156} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=FOXA2 OC=Anatinae; Anas.
Sequence
PQSYSSVSNMNAGLGMNSMNTYMTMSAMSTTANAATTMNMSYANTGMSPSLTGMSPGAGA
MPGVAGMGAHLSPSMSPMGGQAGSMNALAPYTNMNSMSPIYGQSNLNRSRDPKTYRRSYT
HAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDC
FLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCAGRQGQRWGGWRGRWRGQE
GARAATXSEGSAGAESPASASPCQDHKRALADLKGTAGLSPGEPAASPAQHLLAPPHAGL
PHDAHLKPEHHYAFNHPFSINNLMSSSEQQMDLKAYEQVMHYSGYASPMPGSLAMGPVTN
KNGLESSPLAGETSYYQGVYSRPIMNSS
Download sequence
Identical sequences U3J3S9
ENSAPLP00000014156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]