SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3J3U2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3J3U2
Domain Number 1 Region: 110-444
Classification Level Classification E-value
Superfamily ARM repeat 1.87e-27
Family Plakophilin 1 helical region 0.085
Further Details:      
 
Domain Number 2 Region: 553-682
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.000000000000942
Family Toll/Interleukin receptor TIR domain 0.0064
Further Details:      
 
Domain Number 3 Region: 477-539
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000886
Family SAM (sterile alpha motif) domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U3J3U2
Sequence length 715
Comment (tr|U3J3U2|U3J3U2_ANAPL) Sterile alpha and TIR motif containing 1 {ECO:0000313|Ensembl:ENSAPLP00000014169} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=SARM1 OC=Anatinae; Anas.
Sequence
MVLTLLVSVYKLCRFFAMSGMERLEVPECVSQAGCWAAGSSGEHREVSPGVNTDVRAALE
RILPALQRSIACAKQAAGPGELRQAIGEVFQLVEEAWGMPTLGRDVAKVLCDVIRLEGGL
DLLLNLLYTAELETKCQAGKLLEQILVAENRDRIARIGLGVILNLAKERDIPPLAQSVSG
ILEHMFKHTEETCSQLISDGGLDAILYWCRWTDPVVLRHCAMALANCAMHGGQANQRLMI
EKRTAEWLFPLVFSRDDELIRLHACLAITVLATNKEIEKEVERSGTLALVEPFIASLDPE
RFACRMLGSSDSSQGRTAEDLQRLVPLLDSSRLEAQCIAAFYLCAEAAIKTRQKQTKIFS
EIGATQSLKRVVCYSTSSTTSSLAKKVLRMIGEEVPRRILPTVPNWKPCEVQTWLQQIGF
NKYCQSFLDHQVDGDILLRLTEEELQEDLGMGSSITRKRFFRELTELKTFANYSTCDRSN
LADWLGGIDPRFRQYTYNLLTCGINRSFLHRVTEQQLQDDCHIATGFHRVRILSAAREML
HSPITLQTASDGTDVFISYRRSTGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQ
SVLSARNFVLVLSPNALDKCMADPECKDWVHKEIVTALNSGKNIVPVTDHFEWPDPETLP
KDMRAVLKFNGIKWSHEYQEATIDKIIRFLQGRSSRDSSAGSENGLDCLPAPGQT
Download sequence
Identical sequences U3J3U2
XP_012960058.1.99704 ENSAPLP00000014169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]