SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3J4W8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3J4W8
Domain Number 1 Region: 5-95
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.36e-40
Family Forkhead DNA-binding domain 0.0000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U3J4W8
Sequence length 303
Comment (tr|U3J4W8|U3J4W8_ANAPL) Forkhead box G1 {ECO:0000313|Ensembl:ENSAPLP00000014545} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=FOXG1 OC=Anatinae; Anas.
Sequence
NGKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSL
NKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGTSAFKRGARLTSTGLTFMDRAGSL
YWPMSPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQNSLGNNHSFSTSNGLSVDR
LVNGEIPYATHHLTAAALAASVPCGLSVPCSGTYSLNPCSVNLLAGQTSYFFPHVPHPSM
TSQSSTSMTARAASSSTSPQAPSTLPCESLRPSLPSFTTGLSGGLSDYFTHQNQGSSSNP
LIH
Download sequence
Identical sequences U3J4W8
ENSAPLP00000014545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]