SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U3J560 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3J560
Domain Number 1 Region: 119-231
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.39e-27
Family DEP domain 0.0000141
Further Details:      
 
Domain Number 2 Region: 1-99
Classification Level Classification E-value
Superfamily PH domain-like 1.98e-23
Family Pleckstrin-homology domain (PH domain) 0.00073
Further Details:      
 
Domain Number 3 Region: 238-301
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000334
Family Pleckstrin-homology domain (PH domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3J560
Sequence length 308
Comment (tr|U3J560|U3J560_ANAPL) Uncharacterized protein {ECO:0000313|Ensembl:ENSAPLP00000014637} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=PLEK2 OC=Anatinae; Anas.
Sequence
LKEGFLVKRGHVVHNWKVRWFVLLQDKLLYYKFEGGKKESSPKGRILLDGCTITCPCLEY
ENRPLLIKLRTKTNTDYFLECCSREERDSWALDITGAIHAGHPVQVQELHRMKNSFKLLE
NISLHHIVDKMRDSSTGIKLTRNLEQGNRYKETFTGSALVDWLISNNFAVSRFEAVTLAS
MLMEENFTKPVGTRSIEAMRYSDLSEQFLDDSTALYMFAESSKKMLSSKEELQFNISELS
GMIVKQGFLVKQGHKRKNWKVRKFVLRAEPAFLHYYDPTKEENKPVGGFSLRGCLVSALE
DNGVPAGK
Download sequence
Identical sequences U3J560
ENSAPLP00000014637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]