SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3J6F4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3J6F4
Domain Number 1 Region: 41-113
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.9e-19
Family Linker histone H1/H5 0.0000411
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U3J6F4
Sequence length 223
Comment (tr|U3J6F4|U3J6F4_ANAPL) Uncharacterized protein {ECO:0000313|Ensembl:ENSAPLP00000015081} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN= OC=Anatinae; Anas.
Sequence
CSNLHPDRRKVMPAFPHAAEAPASARRGGCPRAVPARGWAGPSVTELITKAVSASKERKG
LSLAALKKALAAGGYDVEKSNSRIKLGLKSLVSKGTLVQTKGTGASGSFRLSKKPGEVKE
KAPKKRAAAAKPKKPAAKKPASAAKKPKKAAVKKSPKKVKKPAAATTTKKAAKSPKKATK
AAKPKKAVAAKSPAKAKAVKPKAAKPKTAKPKAAKAKKAAPKK
Download sequence
Identical sequences U3J6F4
ENSAPLP00000015081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]