SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3J6I0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3J6I0
Domain Number 1 Region: 2-67
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.74e-21
Family Vacuolar sorting protein domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U3J6I0
Sequence length 68
Comment (tr|U3J6I0|U3J6I0_ANAPL) Vacuolar protein sorting 25 homolog {ECO:0000313|Ensembl:ENSAPLP00000015107} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=VPS25 OC=Anatinae; Anas.
Sequence
KLIYQWVSKNGLTNSVFTLYELVSGDDTAEEEFHGLDEAMLLRALQALQQEHKAEIITLD
DGRGVKFF
Download sequence
Identical sequences U3J6I0
ENSAPLP00000015107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]