SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3J8G1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3J8G1
Domain Number 1 Region: 14-409
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.6e-95
Family Ankyrin repeat 0.00000634
Further Details:      
 
Domain Number 2 Region: 1219-1286
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000558
Family SAM (sterile alpha motif) domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U3J8G1
Sequence length 1786
Comment (tr|U3J8G1|U3J8G1_ANAPL) Kinase D interacting substrate 220 {ECO:0000313|Ensembl:ENSAPLP00000015789} KW=Complete proteome; Reference proteome OX=8839 OS=Anas platyrhynchos (Mallard) (Anas boschas). GN=KIDINS220 OC=Anatinae; Anas.
Sequence
MASLMSQSLLTYVEEGNVPALKALLEKCRDVDERNENGQTPLMLAAEQGNLEIVQELLKK
GANCNLEDADNWTALISAAKEGHAAIVAELLNYNVNLEHRDLGGWTALMWASYKGRTEVA
KLLLEKGANPNITGMQYSVYPIIWAAGRGHSDIVHLLLQYGAKVNCSDKYGTTPLVWAAR
KGHLECVKYLLQMGADVDQEGANSMTALIVAVKGGYTDSVKEILKRNPNVNLTDKDGNTA
LMIASKEGHTEIVQDLLDAGTYVNIPDRSGDTVLIGAVRGGHVEIVRALLHKYADIDIRG
QDNKTALYWAVEKGNATMVRDILQCNPDTEICTKDGETPLIKATKMRNIEIVELLLDKGA
KVSALDKKGDTPLHIAIRGRSRKLAELLLRNPKDGRLLYRPNKAGETPYNIDCSHQKSIL
TQIFGARHLSPTESDGDMLGYDLYSSALADILSEPTMQPPICVGLYAQWGSGKSFLLKKL
EDEMKTFAGQQIEPLFQFSWLIVFLTLLLCGGLGLLLAFTVDAKLGIAVSLSLLAVLYIF
FTVIYFGGRREGESWNWAWVLSARLARHIGYLELLLKLMFVNPPELPEQTTKALPVRFLF
TDYNRLSSVGGETSLAEMIATLSDACEREFGFLATRLFRVFKTEDTQGKKKWKKTCCLPS
FVIFLFILSCVVSAIALLAIFNVEPTNMTVNVILITVTCVVGLAFILNCRTWWQVMDSVL
NSQRKRLHNAASKLHKLKSEGFMKVLKCEVELMAKMAKTIDGFTQNQTRLVVIIDGLDAC
EQDKVLQMLDTVRVLFSKGPFIAIFASDPHIIIKAINQNLNSVLRDSNINGHDYMRNIVH
LPVFLNSRGLSNAKKLMVASTTNGDVPYTDNAGLHEEVDRRVSQNSLGEMTKLGSKTALN
RRDTYRRRQMQRTITRQMSFDLTKLLVTEDWFSDISPQTMRRLLNIVSVTVLGRLLRANQ
ITFNWDRLASWINLTEQWPYRTSWLILHLEETEGVPDQLTLKTIYERISKNIPTTKDVEP
LLEIDGDIRNFEVFLSSRTPVLVARDVRTFLPCTVNLDPKLREIIADVRAARDQMNIGGL
PYPTLPLHEAPARATSLFSQPSSACSSTTSFNGPFNSGVLSPQPHSSYYSGMTGPQHPFY
NRPFFAPYLYMPRYYPGSSHLISRPPLKTSLSRDQNNGLDVIKEDADEGLASPTDPSMGG
GAGTGSTTGVSHVSLSTMSVEAVCEKLKQIDGLDQSMLPQYSATIRKANINGRVLAQCNI
DELKKEMNMNFGDWHLFRSMILEMRNSENQAVQEDPRGTTEHAASAISHSELTRRPGHST
ELPHTELTGLSGQAPYTLNFSFEELNTIGLDEAPPRHSNLSWQSQTRRTPSLSSLNSQDS
SIEISKLTDKVQAEYRDAYREYIAQMSQLEGGASSTTVSGRSSPHSSSAFYMGQSTSGGS
LHSSAEQEKGKDGEQKQDDGRKSFLMKRNDVIDYSTSGVSTNDASPLDPITEEDEKSDQS
GSKLLLGKKSSERTSIFQAADLKLKGVTLRYQKLPSDEDESGTEESDNTPLLKEGKDKKT
DVKIDKQPKSPEHGSEPIRTFIKAKEYLTDALLDKKDSSDSGVRSNESSPNHSLHNEGAD
DSQLEKANLIELEDDSHSAKRGIPHSLSGLQDPAVVRMSICSEDKKSPSESSLIASSPEE
NWPACQKVYNLNRTPSTVTLNNNSAPNNRANQNFEEIQGTRDSSQIILHPSSGSNSTAVQ
NENLKSVAHKRSQRSSYTRLSKDSSELNTVTASEGAGFGEERESIL
Download sequence
Identical sequences U3J8G1
ENSAPLP00000015789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]