SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3JIW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3JIW2
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-56
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 2 Region: 179-413
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-49
Family YWTD domain 0.00000341
Further Details:      
 
Domain Number 3 Region: 784-1043
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-40
Family YWTD domain 0.0000393
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 1.23e-27
Family YWTD domain 0.0000529
Further Details:      
 
Domain Number 5 Region: 738-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000314
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1174-1212
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000864
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1096-1134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 436-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000207
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 9 Region: 1136-1172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 10 Region: 132-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000223
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1053-1106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000981
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U3JIW2
Sequence length 1460
Comment (tr|U3JIW2|U3JIW2_FICAL) LDL receptor related protein 6 {ECO:0000313|Ensembl:ENSFALP00000002716} KW=Complete proteome; Reference proteome OX=59894 OS=Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis). GN=LRP6 OC=Ficedula.
Sequence
MYWTDWGEVPKIERAGMDGSSRSIIVNTDIYWPNGLTLDYEEQKLYWADAKLNFIHKSNL
DGSHRQAVVKGSLPHPFALTLFGDTLYWTDWNTHSILACSKYSGEDLREIHSNIFSPMDI
HAFSQKRQPNATNPCGINNGGCSHLCLMSPTKPSYQCACPTGVKLLENGKTCKDGATALL
LLARRTDLRRISLDTPDFTDIVLPLEDIRHAIAIDFDPLEGYIYWTDDEVRAIRRSFLDG
SGSQFVVTAQIAHPDGIAVDWLARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAI
VLDPMVGYMYWTDWGEIPKIERAALDGSDRIVLVNTSLGWPNGLALDYAESKIYWGDAKT
DKIEVMNADGTGRRVLVEDKLPHIFGFTLLGDYIYWTDWQRRSIERVHKCTAEREIIIDQ
LPDLMGLKATNVHQIIGTNPCAEDNGGCSHLCLYRPQGLRCACPIGLELISDMRTCIVPE
AFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFM
NGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPR
ALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLD
TNLIESSNMLGLDREIIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQG
HLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNSDNRTCSA
PTTFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNIIRK
AQEDGSQSLTVVTSPVPNQNLDMQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRPMGVV
LKGDQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALAIDS
QLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDRQQQMIEKID
MTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCSQDNGGCSHICIVKGDGTTRCSCP
VHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDEKNCPVCSDT
QFQCESGQCIDSVLRCNGEANCQDNSDEKNCEVLCLTDQFRCASGQCIGKSKKCDHNLDC
SDSSDEQGCYTTEEPAPQPNNTIGSIIGVILTVFVVGAMYFICQRVLCPRMKGDGETMTN
DYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMGGSSGPPYDRAHVTGASSS
SSSSTKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTP
CSTDVCDSDYGPSRRLPAAAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENCESCPPSPYT
ERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences U3JIW2
ENSFALP00000002716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]