SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3JMF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3JMF6
Domain Number 1 Region: 41-165
Classification Level Classification E-value
Superfamily dUTPase-like 2.62e-18
Family dUTPase-like 0.0017
Further Details:      
 
Domain Number 2 Region: 162-221
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000026
Family Retroviral protease (retropepsin) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U3JMF6
Sequence length 225
Comment (tr|U3JMF6|U3JMF6_FICAL) Uncharacterized protein {ECO:0000313|Ensembl:ENSFALP00000003960} KW=Complete proteome; Reference proteome OX=59894 OS=Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis). GN= OC=Ficedula.
Sequence
QLRQTESQFGFKSEPVKQMLDYLFDTQVLLPNDLQGISRLMFTLQPATAGSLSLDLAATI
DVTLYTNRPERIPTGIKGPVIINGQTFGALLLGQSSASIMGLFVLPGVIDADFTGEIQIM
GHTPYPPLKIEKGQHIAQLVPLLQLTTGLVPKAIDPQDTKGFGSTRLTLLTLDLRDRPKK
PIRITYNTKEISTMALLDTGADTSIVSPEIWPTHWPSYASTQTVT
Download sequence
Identical sequences U3JMF6
ENSFALP00000003960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]