SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3K540 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3K540
Domain Number 1 Region: 684-831
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.64e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1012-1108
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-30
Family Ras-binding domain, RBD 0.00079
Further Details:      
 
Domain Number 3 Region: 226-359
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-22
Family Phosphotyrosine-binding domain (PTB) 0.024
Further Details:      
 
Domain Number 4 Region: 8-102
Classification Level Classification E-value
Superfamily PDZ domain-like 5.92e-20
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 957-1026
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000945
Family Ras-binding domain, RBD 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U3K540
Sequence length 1505
Comment (tr|U3K540|U3K540_FICAL) Regulator of G protein signaling 12 {ECO:0000313|Ensembl:ENSFALP00000010144} KW=Complete proteome; Reference proteome OX=59894 OS=Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis). GN=RGS12 OC=Ficedula.
Sequence
MYRPGETVKRRLNMHAPARIRSVEVARGRAGYGFTLSGQAPCVLSCVMKGSPADYVGLKA
GDQIFAVNEINVKKASHEDVVKLIGKCSGVLHMVIAEGINHMDSCSSDEEVGFYDGKGWL
KPKPDSKALGINRAEKVVEEMQSGGIFNMIFENPALCAGNSDNSAPKQRSFSVSAAMKFE
TGNESVSNPNLLSKEEIAKVLNDDSVFRIGLESAEDFGLDASILNVAMIVGYLGSIELPS
TTANLETESLQAIRGCMRRLRAEQKIHSLVMMKIMHDCIQLCSDKSGVVAEYPAEKLAFS
AVCPDDRRFFGLVTMQTNDDASLAQEDEGVLRTSCHVFMVDPELFHHKIHQGIARRFGLE
CTADPDTNGCLEFPTSSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSSNS
DSGIGNFNQEEKNNRVLVVDLGTNPSKHIPSSIWENPVGRGQNQPASHWNGFCHEQEGNM
PLEVIQNDKAQNVSKHLSPSARIEVPLVSTRNSVPPSKKTAAGTGSQRWLPVHVLQEWQH
GNASDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVDGSFGQPQLKSHKSEWSKKVFC
IQNKFGPPHSIRKSKEDKKGAKFGHSMGLNQAPPPRSSARRSFGRSKRFSITRSLDDLES
ATVSDGELNSTELKDCISENSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDSVGVK
YFSEFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQ
AQLADDILNSPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRPLPDPQRV
PSSPTSKHSVSSEKSNISTPKKLSGKSKSGRSLNEESGEEDTEKKKRGTFFSWSRSKSLG
KSQKRRENGDYPNDSFQSNGLSYRRESQGSMSSTASLDLSETSRLPAFVPDKDKSPKYCC
VNLPDGSSSKMAVKSGFSIKEVLSGVCEKHGINIAAVDLFLVGGDKPLVLHQDSSILESR
DLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLNLNELVARLSGEQEPL
DLGVPISNLDGQRVVLDEKEPSKGREKQRGVLVKQTATVSSSRSQGSTGEGRTLGKSNSI
KMKGENGKNAREVRLSKREDSIAKIGKKKCQKINLDEAEEFFELISKAQSNRADDQRGLL
RKEDLILPDFLRLPPTGPEPSSSTPAGPKGLSKRVSKSDGSDGCTSPSGKQEPVQNFNEN
SVKKMGYSESKHKSALAALHSQKTFSVPFSPPLSPIPHAQENNATVWKRQSRELQAEGIQ
MVDDENVADLTLVAEGDISSPNSTLLPPPPPTPPSDISKLTEANYPPPTPFAGNQEKSGY
QRSNSGANRKKNYSQGTSGKSCEQSSHKAKPSRSFNPPGVRGTPGMELPVNRIIDVDGVK
LEDSGTRSCDDSEGNLSFEGYISELRSCQGRMRTGVYRTSDLPSLIAVKTEKNKATENQY
KATFV
Download sequence
Identical sequences U3K540
XP_016153600.1.66865 ENSFALP00000010144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]