SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U3Q5A6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U3Q5A6
Domain Number 1 Region: 20-214
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.96e-50
Family PP-loop ATPase 0.0000952
Further Details:      
 
Domain Number 2 Region: 372-449
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000000314
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U3Q5A6
Sequence length 451
Comment (tr|U3Q5A6|U3Q5A6_9FLAO) tRNA(Ile)-lysidine synthetase {ECO:0000256|HAMAP-Rule:MF_01161} KW=Complete proteome OX=1316444 OS=Blattabacterium sp. (Nauphoeta cinerea). GN=K645_2016 OC=Blattabacteriaceae; Blattabacterium.
Sequence
MLVKIIMNEISYNLIFLDKIKKYFSFNSKMEIRKKVCVAVSGGLDSMVLINLLLKIPEIE
SEVAHCNFSLRDEESNQDEIFIKNFCTKQNIICHVKKFDTLNFSKKWKLSIQMTARKLRY
DWFEELLKKNSYEYMVLGHHFDDSIETFFINVFRGTGMKGLLGIPKKNGRFIRPLSDFTK
KEILHYAKIKNIKWRFDTSNQDFKYLRNKIRSVLSMFYSCSFRNGLKKTINFLHEENFLI
EQKIEEVRQEITIEKKDSPFFWRMNCKKIRELQPLSFYLFKLFSPYGFNDINSMRRLIYA
QSGKQLLSKLKLYRLIKNRTNWILVSHQLLSINQNKIYMISNLKVTNKMFLPVDIKFFYN
PKKETNKNMLIIDFEKIQFPLLLRTWRKGDFFYPFKMKGKKKISKYYKEKKFSLLEKEHT
WLLINGNEHIILVIGNRLDDRFKVTKNTKKY
Download sequence
Identical sequences U3Q5A6
gi|549684093|ref|YP_008658134.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]