SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U5FSN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U5FSN5
Domain Number 1 Region: 106-214
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.89e-30
Family B3 DNA binding domain 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U5FSN5
Sequence length 405
Comment (tr|U5FSN5|U5FSN5_POPTR) Uncharacterized protein {ECO:0000313|EMBL:ERP53194.1} KW=Complete proteome; Reference proteome OX=3694 OS=subsp. trichocarpa). GN=POPTR_0014s10290g OC=Populus.
Sequence
MNFVGGERGYFDKEEQEEEEAMSSKLPFASPCTSSSSSKYKNFLPEHQNLWPRLFDQPRQ
DSETQEPSLNFVKKLEFMELSLGNNNESESSSTDAGGGASESIEREHMFDKVVTPSDVGK
LNRLVIPKQHAERYFPLDSSSNEKGLLLNFEDRNGKPWRFRYSYWNSSQSYVMTKGWSRF
VKEKRLYAGDIVSFQRGVGETGKHRLFIDWRRRPNAPDPTSFSHLELQNQLHYPQSLRWG
RLYSMPQSNLPMQQPQLQHLNYSIHPYQQHQHHNHQYHYHQPSNISYGNAAQYYLRPPAS
TLPIGAVHEQGGSHVPVVIDSVPVVHGKTVGKRLRLFGVNMECPTQNDPSSSVTMIRHGT
LDSLSPRLASSSLPPPFQVREPTGAPMQAEFSKKGKASLSFDLDL
Download sequence
Identical sequences U5FSN5
POPTR_0014s10290.1|PACid:18222541 XP_006375397.1.11743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]