SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U5NAQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U5NAQ2
Domain Number 1 Region: 198-336
Classification Level Classification E-value
Superfamily CBS-domain pair 2.15e-20
Family CBS-domain pair 0.0067
Further Details:      
 
Domain Number 2 Region: 346-433
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 5.18e-19
Family CorC/HlyC domain-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U5NAQ2
Sequence length 436
Comment (tr|U5NAQ2|U5NAQ2_9BURK) Hemolysin-like protein {ECO:0000313|EMBL:AGX87279.1} KW=Complete proteome; Reference proteome OX=946483 OS=Candidatus Symbiobacter mobilis CR. GN=Cenrod_1186 OC=Comamonadaceae.
Sequence
MEVLLILLLIVLNGLFAMTELALAACRRARLSALAAEGDRGARAALELLDQPDQFLSTIQ
IGITSIGVLNGIIGEAAFSPQFAAWMCSLGTPDAIAHVVATGLVVTIVTFLTIVCGELVP
KRIGQLYPETVSRWMSQPMQWLARIARPFVSLLAQSTAAMLRLLRIDTQATHSMTEAEIS
ASLEEGLDAGVIEAQEHQMMHNVLALDDRPLTSMMVPRSEVDWLDADATVEAALARLRDD
AGGSTHSWYPVCRGSLDEVLGKISVARLLELGAEAPGTLAKYASEVAFVPETLSGMELLE
QLRLEAGRMVLVVDEYGVVQGLLTPHDLLEAITGELQPASCADAWAVEREDGSWLLDGVM
PVAELKSRLGIDELPLEQRHRYHTLAGFLMATSGHLLATGETVRCGAWQFEVVDLDGRRV
DKVLASRLPTEDAPPS
Download sequence
Identical sequences U5NAQ2
gi|550990772|ref|YP_008681382.1| WP_022772125.1.16511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]