SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U5VBK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U5VBK1
Domain Number 1 Region: 15-189
Classification Level Classification E-value
Superfamily ClpP/crotonase 5.52e-27
Family Clp protease, ClpP subunit 0.033
Further Details:      
 
Domain Number 2 Region: 360-427
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000000497
Family NfeD domain-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U5VBK1
Sequence length 436
Comment (tr|U5VBK1|U5VBK1_9PSED) Membrane-bound protease {ECO:0000313|EMBL:AGZ33055.1} KW=Complete proteome OX=69328 OS=Pseudomonas sp. VLB120. GN=PVLB_01225 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MLGTFQSGLAAPAPVWLLSIDDAIGPASADYLIRSLEQAHEQGAQLVVIRMDTPGGLDSA
MRQMIKAILASPVPVASYVAPSGARAASAGTYILYASHVAAMAPGTNLGAATPVQIGAPP
GTPKDDKAKPSGDEDALARKQVNDAAAYIRGLAQLRGRNATWAEQAVREAVSLSASEALR
LKVVDLVASDLPDLLRQLDGKTLTAADQPRPLQTDGARVVEHLPDWRTRLLAVITNPSVA
LILIMIGVYGLLFEFMNPGSGVGGVVGGICLLLALYALQLLPVSYAGVALILLGLAFMIA
EAFLPSFGVVGFGGIVAFVVGAVILMDTDAPGFGIPLALIVTLAVASALLLGGVVGMALR
ARRRALVSGDAGLVGSLVKVTQVMADNPFCGSVQAQGEQWQVQCKTPLQVGQSVRVMARH
GVMLDVSAAAPGAQGE
Download sequence
Identical sequences U5VBK1
gi|557220967|ref|YP_008761182.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]