SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U5VEF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U5VEF7
Domain Number 1 Region: 174-266,359-544
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.32e-69
Family Tail specific protease, catalytic domain 0.0000646
Further Details:      
 
Domain Number 2 Region: 247-321
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000241
Family PDZ domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U5VEF7
Sequence length 693
Comment (tr|U5VEF7|U5VEF7_9PSED) Carboxyl-terminal protease {ECO:0000313|EMBL:AGZ34060.1} KW=Complete proteome OX=69328 OS=Pseudomonas sp. VLB120. GN=PVLB_06265 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MKHFLPSTALALMIGLGSLTLGGNAAAANKWDSLQPDRDEIVASLNVVELLKRHHYSKPP
LDDARSVIIYDSYIKLLDPARSYFTAADIAEFDKWKTQFDDFLKSGNLDPGFTIYKRYLD
RVKQRLDFALAELAKGVDKMDFTANESLLVDRKDAPWLKNQAELDDLWRKRVKDEVLRQK
IAGKDPKQIQETLTKRYKNQLARLDQTRAEDIFQAYINTFAQSYDPHTNYLSPDNAENFD
INMSLSLEGIGAVLQSDNDQVKIVRLVPAGPAAKTKQVAPADKIIGVAQGNKEMVDVVGW
RLDEVVKLIRGPKGSVVRLEIIPASNAPNDQTSKIVSITREAVKLEEQAAKKSVLKLKQD
GREYKLGIIEIPAFYLDFKAYRAGDPEYKSTTRDVKKLLTELQKEKVDGVVIDLRNNGGG
SLQEATELTSLFIEKGPTVLVRNSDGRVDVLEDENPGAFYKGPLALLVNRLSASASEIFA
GAMQDYHRALIIGGQTFGKGTVQTIQPLNHGELKLTLAKFYRVSGQSTQHQGVLPDIDYP
SIIDTKEIGESALPEAMPWDTIRPVVRPAADPFKPFLSQLKAQHEARSAKDAEFTYIRDR
LALTQKLMNEKTVSLNEQTRRARHDEIEGKQLALENIRRKAKGEEPLKELKKEDEDALPA
EEENTKPEDDAYLSETGRILLDYLSLSSAVAKH
Download sequence
Identical sequences U5VEF7
gi|557221972|ref|YP_008762187.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]