SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U5VI09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U5VI09
Domain Number 1 Region: 4-168
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.04e-26
Family Clp protease, ClpP subunit 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U5VI09
Sequence length 183
Comment (tr|U5VI09|U5VI09_9PSED) Peptidase S14 ClpP {ECO:0000313|EMBL:AGZ35291.1} KW=Complete proteome OX=69328 OS=Pseudomonas sp. VLB120. GN=PVLB_12515 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MARHIIHFTGPINSSTCGNLISTCGKAIQQGADVLQLNIATMGGECSYGFTLYNFLRSLP
IALHTHNLGTVESMGNILFLAGEHRTACSYSKFLFHPFHWTLHGSVDHARMAEYAMSLDY
DLRLYAQIVAERTEGSAEALDVPRYLMAYPRILGPHEALQSGLIHAIDELAIGSEATQWS
VHA
Download sequence
Identical sequences U5VI09
WP_023380572.1.72310 WP_023380572.1.91273 gi|557223203|ref|YP_008763418.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]