SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U5W5S6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U5W5S6
Domain Number 1 Region: 28-305
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 7.19e-47
Family ADP-ribosylglycohydrolase 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U5W5S6
Sequence length 319
Comment (tr|U5W5S6|U5W5S6_9ACTN) Putative ADP-ribosylglycohydrolase {ECO:0000313|EMBL:AGZ44494.1} KW=Complete proteome; Reference proteome OX=1246995 OS=Actinoplanes friuliensis DSM 7358. GN=AFR_31170 OC=Actinoplanes.
Sequence
MTKKASGMLRGPMTFTLFPESRLALATDSLAGLSVGDALGAQYFVPGNAAADLARGDLPT
PPWPWTDDTEEACCLVAVLTGSDELSFDRDRFADLLSEQFDAYRGYGPGAVVMLRQIREG
TPWPIAAAAAFDGQGSAGNGAAMRAAPLGAWHADSLAHAAAQAVRAAEVTHAHPEGIAGG
VAVAVAAAMAAAARLDGHRPPAGQLLAAVAGLVTPGHVQDGLRRAVRIKDAAEAAYELGT
GSRAMAQDSVPFAIWVAAQHLDNYPAAITACVAGGGDVDTTAAMAGGIVAAYTGVDGIPA
AWLAAREPLPKWVAASREG
Download sequence
Identical sequences U5W5S6
gi|556569122|ref|YP_008737547.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]