SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V4HRV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4HRV5
Domain Number 1 Region: 123-439
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.71e-58
Family Carboxypeptidase T 0.085
Further Details:      
 
Domain Number 2 Region: 626-743
Classification Level Classification E-value
Superfamily PKD domain 0.000000000562
Family PKD domain 0.01
Further Details:      
 
Domain Number 3 Region: 576-651
Classification Level Classification E-value
Superfamily PKD domain 0.00000353
Family PKD domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4HRV5
Sequence length 744
Comment (tr|V4HRV5|V4HRV5_9GAMM) Zinc carboxypeptidase {ECO:0000313|EMBL:ESP90654.1} KW=Complete proteome OX=1353533 OS=Pseudoalteromonas luteoviolacea 2ta16. GN=PL2TA16_01758 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MNKNIIKAGVLSALSMVTTSAYTHNQKTPEQALNLQTNQSNYLLYFDSPEQKAHYSGLYH
EQIIDASHNAFKLSLSKAEYRTILQTGVIIVEQNVAESFAAPALPKTKKSMSITPSSGAE
ELTSIPNFPCYPTVEETHKRAQQLAEKYPDFVELKTIGPSWEKSQGIGGYDLNVLVLKNK
KRNKNKQLPALFMQSVLHAREYTPGATTLRLAEHLLENRKTDADIHWILNQREIHILLIA
NPDGRKYAEQGLFWRKNTNASYCAQSEQNRGVDLNRNFDFAWATTSGSTDEQCASKFHGP
SPASEPETQAIQAYVKALFGDNRGDALNDAAPLDTPGVFIDIHSYSRFVMWPWSHETTPP
PNAAGLSMLGHRMAAYNDYLALQVSEQFNGGGSAEGYAYGELGVAAYTFELGSTFFENCS
NFEGEILPNNLQALIYAAKVAKKPYKLSGGPKIVDFRLEGAGETAVPAGTSINLIADVHD
DAFGPSLSGVAPPSQAIKKVRMTVRKQGEGRIQRLILPPVDGIYDSPREKINYALDTSDW
DDGRYTVIIKAQDTTGQWGVKYAKYLTIDDDASEQNQAPIANFTPNCTFGACKFDASNSI
DDKAGLKYRWYISNDATQFEYFGKQIEFVNQRAGTYTIALEIEDANGVRANKEVVMELQG
TVPPIAKLTYQCNGLTCEFDSSGSTDADGQIVRRLWRIGSDDGFADGDVKVTRTFPAPGE
YIVSVVVLDNHDEYSQVIETITVK
Download sequence
Identical sequences V4HRV5
WP_023402011.1.60081 WP_023402011.1.99810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]