SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V4JW57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4JW57
Domain Number 1 Region: 15-76
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000765
Family B3 DNA binding domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4JW57
Sequence length 79
Comment (tr|V4JW57|V4JW57_EUTSA) Uncharacterized protein {ECO:0000313|EMBL:ESQ29670.1} KW=Complete proteome; Reference proteome OX=72664 OS=Eutrema salsugineum (Saltwater cress) (Sisymbrium salsugineum). GN=EUTSA_v10024065mg OC=Eutrema.
Sequence
MEEEARIIHEKYLKIRKTGLIVVLVDPLSKRHVVDLRKWKISGNLVYVISTGWWDMVIAN
KFKVGDVYPVWYFRFGQAK
Download sequence
Identical sequences V4JW57
Thhalv10024065m|PACid:20200950 XP_006392384.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]