SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V4LAF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4LAF6
Domain Number 1 Region: 265-365
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-20
Family B3 DNA binding domain 0.0059
Further Details:      
 
Domain Number 2 Region: 132-227
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.19e-20
Family B3 DNA binding domain 0.0045
Further Details:      
 
Domain Number 3 Region: 3-106
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.14e-18
Family B3 DNA binding domain 0.0056
Further Details:      
 
Domain Number 4 Region: 411-487
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000196
Family B3 DNA binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4LAF6
Sequence length 503
Comment (tr|V4LAF6|V4LAF6_EUTSA) Uncharacterized protein {ECO:0000313|EMBL:ESQ47410.1} KW=Complete proteome; Reference proteome OX=72664 OS=Eutrema salsugineum (Saltwater cress) (Sisymbrium salsugineum). GN=EUTSA_v10028050mg OC=Eutrema.
Sequence
MVNKHFFKPILPGFHSHLTIPVAFFSKYIQGTNEQKMTTAKLRSDVSKTAWKVKIEEDGQ
KLTDGWKQFALAHDLRTGDILIFRHEKGMSFHVEILGPSGCEVQYESCSDDKSSLVKKNP
RKETKSSSLVDHSRFVANVAPSTLSDDALNIPMSFARANGLGTRCGEIVLMNEKGRSWNL
ALKQKKCGKIYIRGGWRSFCSANGLNVGDLFTFNLFQRGKTPVLRLSTTESGEEEESSEE
KTQRKKKVEKNPKTEAGSSSSSLDPSCFVAKISPATLRYDSLRLPVKFWRENGLNRRCGE
IVLMNEKGTSWTLNLKQKRSSCGTMFIRRGWRSFCRANGLRAGDSITFKLIQRGGNLFLR
LTSTESKEECSEGDEIESLSTESESDHEEMDQDEKSFKNPRSLWKASSSASQNLFLTLTL
KPYNLTKSNLYLPVTFTKFHGINEETKMHLLDKHGVKWYTNLRSAEKGKKIRLVGGWKDF
FKANCLIWEGDTRCVLQFCSKVK
Download sequence
Identical sequences V4LAF6
XP_006405957.1.70970 Thhalv10028050m|PACid:20189955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]