SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V4LZ34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4LZ34
Domain Number 1 Region: 11-102
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.02e-23
Family B3 DNA binding domain 0.00016
Further Details:      
 
Domain Number 2 Region: 177-258
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000255
Family B3 DNA binding domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4LZ34
Sequence length 270
Comment (tr|V4LZ34|V4LZ34_EUTSA) Uncharacterized protein {ECO:0000313|EMBL:ESQ45158.1} KW=Complete proteome; Reference proteome OX=72664 OS=Eutrema salsugineum (Saltwater cress) (Sisymbrium salsugineum). GN=EUTSA_v10010633mg OC=Eutrema.
Sequence
MSETEDDAVLPRFFKVFLSETSSESMRIPVSFNEHLEDPLPRTAKLHGTGGGIWTVGFTK
RRKRVYFTDGWSKFAEDHDLKDGEFLTFVYDGYHTFEVSVYDGLGCKETRAVTEAVELSD
ADSDSDEEEEEDPSVKGEDDSSYAEDEEVSQSNYTVDSEGTESDSSDISDLVVTTNPWFK
TNLKNRTYELLIPAKLAREYRLKFGESITYIDEEGTMVGIRVRWSDDRICFKGWDRICRR
NRLNKQDQVICEMLHNRKLVHTIKIHIKRG
Download sequence
Identical sequences V4LZ34
XP_006403705.1.70970 Thhalv10010633m|PACid:20207509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]