SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V4N8N6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4N8N6
Domain Number 1 Region: 65-154
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 2.75e-33
Family Translation initiation factor IF3, C-terminal domain 0.00000828
Further Details:      
 
Domain Number 2 Region: 1-61
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 4.45e-24
Family Translation initiation factor IF3, N-terminal domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4N8N6
Sequence length 154
Comment (tr|V4N8N6|V4N8N6_PASMD) Translation initiation factor IF-3 {ECO:0000256|HAMAP-Rule:MF_00080, ECO:0000256|RuleBase:RU000646} KW=Complete proteome OX=1331042 OS=Pasteurella multocida subsp. multocida P1062. GN=P1062_0207480 OC=Pasteurellaceae; Pasteurella.
Sequence
MIDQDGEQAGIVSIQQALEMAEQAELDLVEISPNAEPPVCRIMNYGKFLYEKGKAAKEQK
KKQKVVQVKEIKFRPGTDEGDYQVKLRSLIRFLEEGDKAKITVRFRGREMAHQDIGLEVL
ERVKNDLAEISVVESAPGRLEGRQAVMVLAPKKK
Download sequence
Identical sequences A0A1E3XIM6 A0A2K2YZA3 V4N8N6
gi|383310244|ref|YP_005363054.1| gi|378774309|ref|YP_005176552.1| gi|15602467|ref|NP_245539.1| gi|386834277|ref|YP_006239592.1| 272843.PM0602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]