SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V4RPG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4RPG7
Domain Number 1 Region: 75-172
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.59e-22
Family B3 DNA binding domain 0.0046
Further Details:      
 
Weak hits

Sequence:  V4RPG7
Domain Number - Region: 377-434
Classification Level Classification E-value
Superfamily Tropomyosin 0.0252
Family Tropomyosin 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4RPG7
Sequence length 444
Comment (tr|V4RPG7|V4RPG7_9ROSI) Uncharacterized protein {ECO:0000313|EMBL:ESR36283.1} KW=Complete proteome; Reference proteome OX=85681 OS=Citrus clementina. GN=CICLE_v10028399mg OC=Citrus.
Sequence
MEEQSEPETPLLQTTKIKRKKTAESKMKLTQGAFDSSKESKSRRKRAMIDDLYDHAKVNS
PVIERAEEVRANLAPSYPSFWKAMVKSNVSHGFWLHLPMRFCKFNMPKIDTVFIVENESG
EEYKINYISQRTALSGGWKAFSDANQLYEGDVLVFHLVEPTRFKAYIVRANGFGNVNADA
KPLNSVPMDDELEVAPKDHSEKRVKKNKRAKRVKPPPGFHRDNNQSNSLMLLETNNGHVE
DQFNNDTEDLGPNKVLPHSESSNFKEMKSIDDFTILVDGLAIDCELSDQHRNKYYDLCCS
QNSFLHDHLLKSINCKLAAEIITQTVNIAEAIRACNLSTSRADYEIWDKTLKGFELLGMN
VGFLRARLNRLMSLAFESEESEVSKRLREVSAEQARAEEEMRSLELKLLRLKETMGRLDS
EVESLKVKAEKHELKFQEEANAPW
Download sequence
Identical sequences V4RPG7
XP_006423043.1.91645 clementine0.9_010284m|PACid:19271821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]