SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V4SJL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4SJL3
Domain Number 1 Region: 204-303
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-20
Family B3 DNA binding domain 0.004
Further Details:      
 
Domain Number 2 Region: 15-113
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-19
Family B3 DNA binding domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4SJL3
Sequence length 309
Comment (tr|V4SJL3|V4SJL3_9ROSI) Uncharacterized protein {ECO:0000313|EMBL:ESR39040.1} KW=Complete proteome; Reference proteome OX=85681 OS=Citrus clementina. GN=CICLE_v10026137mg OC=Citrus.
Sequence
MVRPARRKSSPSDKSTDSEFFKVYLPAFSSKQLAIPPAFAKHLNVTVPKHVIIRDYAGRQ
WRGKMEEVEGVIVIKDCWERFACVHSLELGDFLVFKYNGSSLFDVKIYGINGCLKEGTNT
THHKKETPIADMNAIPVKKEIGREAEQTSIMDDPSCNQDDLEIMLISSGKRGGSSVASRV
KTRLRDEKDTGEDRAFKAARLVVPKNPHFVSVFSQYSRYAVNVSVRVVRSHGIKLEPEMM
LRDQNGRKWPVKISFRTNGRIVITGGWSDFWREQKLEAGDKCVFEFVLTRGNMSKEMKVQ
VVRKMKTCL
Download sequence
Identical sequences V4SJL3
clementine0.9_016578m|PACid:19285015 XP_006425800.1.91645 XP_006466673.1.29302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]