SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V4SQ52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4SQ52
Domain Number 1 Region: 298-400
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.24e-20
Family B3 DNA binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4SQ52
Sequence length 890
Comment (tr|V4SQ52|V4SQ52_9ROSI) Uncharacterized protein {ECO:0000313|EMBL:ESR42817.1} KW=Complete proteome; Reference proteome OX=85681 OS=Citrus clementina. GN=CICLE_v10011039mg OC=Citrus.
Sequence
MESRTCMNGKCRASSSIEWRKGWPLQSGGFAVLCDKCGSAFEKLIFCDEFHSKDSGWRKC
ASCSKRLHCGCIASLSLIQLLDGGGVWCINCAKNPGLDSIPGDDPNGFGTLKTDNAGDLP
STSVDNQLGGSDDKFKLLQLGNSSESVGLRHLLQFRNDDLDGSFRKVKPEEAAKSDISKA
NIGAKDIYGPLAHTNLSITLGSPGINSNSFPSAVVDEKEHSKTSAIIHQGPKSRHLLPKP
PKLALATGSEANAGISQIRVARPPAEGRGRNQLLPRYWPRITDQELQQLSGDSNSTIVPL
FEKVLSASDAGRIGRLVLPKACAEAYFPPISQPEGLPLRIQDVKGKEWVFQFRFWPNNNS
RMYVLEGVTPCIQSMQLQAGDTVTFSRMDPEGKLVMGFRKASNAVSVQDTQPSAIPNGGH
SSESFFSGVFENLSILSGYSGVLQSLKGSTDPHLSSLSKQLNSPPGDINWVKSEKHEDKT
REGLLPPSMLVPERKRSRNIGSKRKRLLIDRLDVLELKLTWEEAQDMLYPPPSVMPSIVT
VEDHVFEEYEDPPVFGKRSIFIVRTSGGQEQWAQCDGCSKWRRLPVDVLLPPKWTCMDNV
WDHNRCSCSAPDELTPREVENLLRLNKDFKKRKIATSHRLNQEHEPSGLDALSNAAILGE
NMGDPGTASVATTTKHPRHRPGCSCIVCIQPPSGKGKHKPTCTCLVCMTVKRRFKTLMMR
KKKRQSEREEEVAQRNQPTWGPKEEAEVDSSSKHVSSHLDPSENEARSANELESKGQNNN
LSGKLAESSKAELDLNCHPEREEAQAGLNRVSMMKLLQVASHPLETYLKQNGLTSLTSDQ
QASSGTLAPPQAAGESEGQLNELASATQERESGGEDNCEPVSDQIPDDPE
Download sequence
Identical sequences V4SQ52
clementine0.9_001979m|PACid:19267551 XP_006429577.1.91645 XP_006481190.1.29302 XP_006481191.1.29302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]