SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V4TRL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4TRL7
Domain Number 1 Region: 117-252
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.36e-38
Family B3 DNA binding domain 0.0023
Further Details:      
 
Domain Number 2 Region: 573-654
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000000235
Family PB1 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4TRL7
Sequence length 690
Comment (tr|V4TRL7|V4TRL7_9ROSI) Auxin response factor {ECO:0000256|RuleBase:RU004561} KW=Complete proteome; Reference proteome OX=85681 OS=Citrus clementina. GN=CICLE_v10019131mg OC=Citrus.
Sequence
MANRLGSLSQPSSNSDDLYRELWKACAGPLVDVPKQGQRVYYFPQGHMEQLEASTNQELN
QRIPLFRLPSKILCRVVNIHLMAEQETDEVYAQITLLPEPSQNEPTTPDPCPADSPRPKV
HSFSKVLTASDTSTHGGFSVLRKHATECLPPLDMNQSTPTQELVAKDLHGYEWRFKHIFR
GQPRRHLLTTGWSTFVTSKRLVAGDTFVFLRGENGELHVGVRCLARQQSSMPSSVISSQS
MHLGVLATASHAVATQTMFVVYYKPRTSQFIISLNKYLEAVNNKFAVGMRYKMRFEGEDS
PDRRFSGTVVGVEDFSPHWKDSKWRSLKVQWDEPASITRPDRVSPWEIEPFVASATPNLV
QPVLAKNKRPRLPMEVPPLDLPSAASAPWSARLAQSHNLTQLSVTAEDKRIDNHVAWHHK
HSDFSSNSNFMSRTQSDGEWLTSPRVKFSQQLFQEAIDDNKNISAWPAHSGHSTPHPSKP
NNDTLLEQVETGRKTETGTSCRLFGIELINHATSSAPSEKVPVSSLTTEGHIISTISAAA
DSDGKSDIAKEFKEKKQEQVQVSPKESQSKQSCLTSNRSRTKVQMQGVAVGRALDLTTLV
GYDHLIDELEEMFDIKGQLHTRTKWEIVYTDDEGDMMLVGDDPWHEFCNMVKRIFICSSQ
DVKKMSPGSKLPMFSIEGEDILLSSDSAEK
Download sequence
Identical sequences V4TRL7
clementine0.9_003997m|PACid:19276700 XP_006439306.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]