SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V4VCW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4VCW7
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-22
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 539-617
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000785
Family PB1 domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4VCW7
Sequence length 665
Comment (tr|V4VCW7|V4VCW7_9ROSI) Auxin response factor {ECO:0000256|RuleBase:RU004561} KW=Complete proteome; Reference proteome OX=85681 OS=Citrus clementina. GN=CICLE_v10030696mg OC=Citrus.
Sequence
MSRQPPTQELAAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGE
NGELRVGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAVSTGTMFTVYYKPRTSPSEFI
VPYDQYMESIKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDADPQRWRDSKWRCLKVR
WDETSTIPRPERVSPWKIEPALAPPALNSLPMPRPKRPRSNMLPSSPDSSVLTREGSSKL
NVDPSSATGFSRVLQGQEFSTLRGNFAERESNESDTAEKSVVWPPSLDDEKIDVVSASRR
YGSENWVPPGRHEPVYTDLLSGFGANADPSHGFSSPFADAVPVRKSVLDQEGKFNLVARP
WSLMPSGPSLKMPESNAKVPVQGGDVNYQVRGNVRYGGFGDYPMLNGNRVEHSHGNWLMP
PLPPSNFENSAHSRELMPKSAMVQDQEAGKSKDCKLFGIPLFSNHVMPEPVVSHRNTMND
PAGNLDQQFRAFESDQKSDHSKSSKLADDNQVFNEHEKLSQPSQTHTKDVRSKTQCGSTR
SCTKVQKQGIALGRSVDLSKFNNYDELIAELDQLFEFDGELMAPKKNWIIVYTDDEGDMM
LVGDDPWQEFCGMVRKIFIYTKEEVLKMNSVSFSSKGEDSPMNGDGIDAKEVKQPLPLAS
NAENF
Download sequence
Identical sequences V4VCW7
clementine0.9_004348m|PACid:19280049 XP_006436944.1.91645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]