SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V5L2H1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V5L2H1
Domain Number - Region: 52-130
Classification Level Classification E-value
Superfamily MIR domain 0.014
Family MIR domain 0.019
Further Details:      
 
Domain Number - Region: 223-256
Classification Level Classification E-value
Superfamily Bacterial photosystem II reaction centre, L and M subunits 0.0575
Family Bacterial photosystem II reaction centre, L and M subunits 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V5L2H1
Sequence length 257
Comment (tr|V5L2H1|V5L2H1_9VIRU) Uncharacterized protein {ECO:0000313|EMBL:AHA45050.1} OX=1420594 OS=Hirudovirus strain Sangsue. GN=HIRU_S144 OC=unclassified Mimiviridae.
Sequence
MSAIRYGDNVFITLPRLSTPMIFNGLVPHYTKPNQYEYVPILSSGSIANGDSYIIEPINI
NNSNTALNPQSVFRLKQVSQNKYLYDNNGIVYLGNDTDNKANWSLKPVNLNATTIDYNQE
FRLVNQGTGNNAVFSTINNVTMITSKYNDTTNNSIFKFLKGPFTYAQSQCCQGNILYTRP
NMCGIYKQGSSVCHTIPSSQSNYPSYTTSMVGSTQSTTPVGSNPPTHRSIDKWYIIGGIF
WVIVLIILVIFIIWKLK
Download sequence
Identical sequences A0A0G2Y8Z7 A0A0U2U1X3 A0A165XJW4 A0A1E1EXH8 E3VXL3 G8EBN4 J3E714 Q5UPR2 V5L2H1
YL778_MIMIV YP_003987310.1.55212 gi|311978190|ref|YP_003987310.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]