SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V5TKB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V5TKB8
Domain Number 1 Region: 17-326
Classification Level Classification E-value
Superfamily SAICAR synthase-like 7.19e-49
Family SAICAR synthase 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V5TKB8
Sequence length 344
Comment (tr|V5TKB8|V5TKB8_HALHI) Phosphoribosylaminoimidazole-succinocarboxamide synthase {ECO:0000313|EMBL:AHB64954.1} KW=Complete proteome OX=1417673 OS=Haloarcula hispanica N601. GN=HISP_02680 OC=Haloarcula.
Sequence
MTSVKEFRVDEPATAEDLGRGAFVFTDDYSVFDWGKMPDRIPDKGASLCTMGAYNFQLLE
ENHVPTHYEGVRLPDSDEVLDLGEALSADAAPEEMVIELTQVPDLPFEDGRYDYDAYHGA
ADENYLIPLEIVFRNRVGVGSSLRSRTEPADHGLDYDTWPEEVVDLDEPIVEFSTKYEEQ
DRYLDREAADRIAGTASIDRLEELARAVNHIVTQQAAEADLVHEDGKIECLYYDGEIRVA
DVVGTFDENRFSYGGQQVSKEVIRQYHKRTQPEWVEAVSEAKEQADAESVADWKSLCAES
PEPLDEDVIQVARDLYCAGTNAYIGGDVFDAPSLDEAVSAAGEL
Download sequence
Identical sequences A0A0B5GJX4 A0A165N3T1 G0HTT2 V5TKB8
WP_014039495.1.13069 WP_014039495.1.27393 WP_014039495.1.67629 WP_014039495.1.92404 WP_014039495.1.92869 gi|344210810|ref|YP_004795130.1| gi|564288813|ref|YP_008875035.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]