SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V5V3U2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V5V3U2
Domain Number 1 Region: 2-200,231-314
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 9.55e-89
Family ATP synthase (F1-ATPase), gamma subunit 0.0000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V5V3U2
Sequence length 315
Comment (tr|V5V3U2|V5V3U2_9CYAN) F-ATPase gamma subunit {ECO:0000256|HAMAP-Rule:MF_00815} KW=Complete proteome OX=1394889 OS=Thermosynechococcus sp. NK55a. GN=NK55_03610 OC=Thermosynechococcus.
Sequence
MANLKAIRDRIKTIKDTRKITEAMRLVAAAKVRRAQEQVMASRPFADRLAQVLYSLQTRL
RFEDVDLPLLAKRPVKTVALLVVTGDRGLCGGYNTNVIRRAKERIQELEAEGLKYTLVIV
GRKAAQYFQRRDYPIDAVYSGLEQIPSASEAGQIASELLSLFLSETVDRVELIYTKFVSL
ISSKPVVQTLLPLDPQGLETADDEIFRLTTRASHLEVNREKVTSTLPALPPDMIFEQDPV
QILDALLPLYLNNQLLRALQEAAASELAARMTAMNNASDNAQALIGTLTLSYNKARQAAI
TQEILEVVAGAEALR
Download sequence
Identical sequences V5V3U2
WP_024124472.1.87165 gi|571027458|ref|YP_008899576.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]