SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V5V453 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V5V453
Domain Number - Region: 11-137
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0173
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V5V453
Sequence length 155
Comment (tr|V5V453|V5V453_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:AHB88151.1} KW=Complete proteome OX=1394889 OS=Thermosynechococcus sp. NK55a. GN=NK55_04110 OC=Thermosynechococcus.
Sequence
MIEIPAPLKPVITFAHPVLMWILFALTLYAMYLGIQTRRLRTLSGEEKKALIQAKVNVKH
HQVGAILLALMVMGTIGGMAVTYINNGKLFVGPHLIVGLAMTALVAISASLTPFMQKGSE
VARALHMTLNLFLVVLFGWQAVTGLQIVQRILNAS
Download sequence
Identical sequences V5V453
WP_024124559.1.87165 gi|571027546|ref|YP_008899664.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]