SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V5V4L4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V5V4L4
Domain Number 1 Region: 61-151
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 1.96e-22
Family Ribosomal protein L9 C-domain 0.00023
Further Details:      
 
Domain Number 2 Region: 5-60
Classification Level Classification E-value
Superfamily L9 N-domain-like 5.76e-16
Family Ribosomal protein L9 N-domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V5V4L4
Sequence length 152
Comment (tr|V5V4L4|V5V4L4_9CYAN) 50S ribosomal protein L9 {ECO:0000256|HAMAP-Rule:MF_00503} KW=Complete proteome OX=1394889 OS=Thermosynechococcus sp. NK55a. GN=NK55_02110 OC=Thermosynechococcus.
Sequence
MAKRVQVVLNETVNKLGRMGQVVEVAPGYARNYLFPRGIAEPATPSALRRVERLQEKERQ
RLAELKVVAEKQKATLEKLATITISMPAGEKDMLFGSVTPKDVAEAIQAITGETVDRRDI
VLPEIRKLGTYAAEIKLHPEVSVKLNIQVVPD
Download sequence
Identical sequences V5V4L4
gi|571027177|ref|YP_008899295.1| WP_024124197.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]