SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V6VCF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V6VCF3
Domain Number 1 Region: 3-192
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.17e-70
Family Nucleotide and nucleoside kinases 0.0000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V6VCF3
Sequence length 205
Comment (tr|V6VCF3|V6VCF3_9BACI) GMP kinase {ECO:0000256|HAMAP-Rule:MF_00328} KW=Complete proteome OX=1408282 OS=Geobacillus sp. MAS1. GN=T260_09630 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MKNERGLLIVMSGPSGVGKGTVRKALFSQPDINLHYSVSVTTRKPREGEVEGVDYFFRTR
EQFEQMIRENKLLEWAEYVGNYYGTPIDYVEKTLAEGKDVFLEIEVQGAMKVRRAFPEAL
FIFLAPPSLTELEKRIMGRGTESKELIENRLRAAKEELEMMDEYDYVVENDEVELACERI
KAIVIAEHCRRERVAERYKRMLGVE
Download sequence
Identical sequences A0A063YWH8 A0A0E0TA11 A0A1V4P721 A0A1V9CTI8 A0A2H5KFI4 L7ZY22 Q5L0S8 S7SR86 T0NP59 V6VCF3
gi|297530658|ref|YP_003671933.1| WP_011230667.1.100150 WP_011230667.1.17728 WP_011230667.1.19233 WP_011230667.1.20723 WP_011230667.1.2219 WP_011230667.1.25743 WP_011230667.1.3446 WP_011230667.1.38928 WP_011230667.1.45808 WP_011230667.1.46340 WP_011230667.1.50933 WP_011230667.1.59104 WP_011230667.1.60903 WP_011230667.1.6497 WP_011230667.1.70239 WP_011230667.1.77642 WP_011230667.1.78869 WP_011230667.1.80994 WP_011230667.1.8599 WP_011230667.1.90668 WP_011230667.1.91533 WP_011230667.1.92435 WP_011230667.1.93593 gi|261419365|ref|YP_003253047.1| gi|448237324|ref|YP_007401382.1| gi|319766180|ref|YP_004131681.1| 235909.GK1167 544556.GYMC61_1948 gi|56419702|ref|YP_147020.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]