SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V6VE41 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V6VE41
Domain Number 1 Region: 20-259
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.55e-59
Family ABC transporter ATPase domain-like 0.0000978
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V6VE41
Sequence length 272
Comment (tr|V6VE41|V6VE41_9BACI) Phosphate-transporting ATPase {ECO:0000256|HAMAP-Rule:MF_01702} KW=Complete proteome OX=1408282 OS=Geobacillus sp. MAS1. GN=T260_18825 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MSTMAVVERRKEDIPSAQLVKKEVVYETNGLNVWYGEHHALKHIHLSFYEREITAIIGPS
GCGKSTYIKTLNRMIELIPNVRLEGEILYRGRRIFDTSYPVEQLRTQVGMVFQKPNPFPK
SIYDNVAYGPRIHGIRDRRRLDEIVEKSLRQAALWEEVKDRLHENALGLSGGQQQRLCIA
RCLAVEPDVILMDEPTSALDPISTAKVEELMGELKTKYSIIIVTHNMQQAARISDRTAFF
LNGEVIEYGETKTLFSRPADQRTADYIAGRFG
Download sequence
Identical sequences A0A063YTJ5 A0A0K1K982 A0A164D800 A0A1C3D6U5 A0A1Q5T3C9 A0A1V4P620 A0A1V9CSP1 A0A2H5KL52 Q5KX47 T0NXE5 V6VE41
235909.GK2454 WP_011231934.1.100150 WP_011231934.1.19233 WP_011231934.1.2219 WP_011231934.1.22479 WP_011231934.1.25743 WP_011231934.1.3446 WP_011231934.1.45808 WP_011231934.1.60903 WP_011231934.1.6497 WP_011231934.1.77642 WP_011231934.1.90668 WP_011231934.1.92435 gi|56420989|ref|YP_148307.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]