SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V6VGF0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V6VGF0
Domain Number 1 Region: 71-290
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.4e-50
Family RecA protein-like (ATPase-domain) 0.011
Further Details:      
 
Domain Number 2 Region: 255-269,303-455
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.93e-44
Family ATP-dependent protease Lon (La), catalytic domain 0.003
Further Details:      
 
Weak hits

Sequence:  V6VGF0
Domain Number - Region: 5-36
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0438
Family Rubredoxin 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V6VGF0
Sequence length 457
Comment (tr|V6VGF0|V6VGF0_9BACI) DNA repair protein RadA {ECO:0000256|HAMAP-Rule:MF_01498, ECO:0000256|RuleBase:RU003555} KW=Complete proteome OX=1408282 OS=Geobacillus sp. MAS1. GN=T260_02040 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MAKKKTKFVCQECGYESAKWLGRCPGCQTWNSFVEEIEQEKPTVRGAFLHSERAGSAKPV
PITAVEAVQEPRMKTNSAELDRVLGGGIVKGSLVLIGGDPGIGKSTLLLQTSAQLAAAGH
QVLYVSGEESVKQVKLRAGRLRAECDQLYVLAEADLEYIVAAVETVQPACVIIDSIQTVY
RTDISSAPGSVAQVRECTAELMKLAKTKGIAIFIVGHVTKEGAIAGPRLLEHMVDTVLYF
EGERHHTYRILRAVKNRFGSTNEIGIFEMRDIGLKEVENPSEVFLEERSRGAAGSTVVAA
MEGTRPVLVEIQALVSPTSFGNPRRMATGLDHNRVSLLMAVLEKRVGLLLQNQDAYLKVA
GGVKLDEPAIDLAVAVSIASSFRDRPTNPADVIIGEVGLTGEVRRVSRIEQRVQEAVKLG
FSRIIVPKNNLAGWQPPKGVQVIGVSHVAEALEHTMC
Download sequence
Identical sequences A0A063Z0S4 A0A1C3D832 A0A1V9BXV1 A0A2H5KI64 Q5L435 T0NZK4 V6VGF0
235909.GK0079 gi|56418614|ref|YP_145932.1| WP_011229594.1.100150 WP_011229594.1.19233 WP_011229594.1.2219 WP_011229594.1.22479 WP_011229594.1.25743 WP_011229594.1.45808 WP_011229594.1.60903 WP_011229594.1.6497 WP_011229594.1.70239 WP_011229594.1.78869 WP_011229594.1.8599 WP_011229594.1.90668 WP_011229594.1.91533 WP_011229594.1.93593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]