SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V6VLC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V6VLC8
Domain Number 1 Region: 4-235
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.49e-55
Family ABC transporter ATPase domain-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V6VLC8
Sequence length 267
Comment (tr|V6VLC8|V6VLC8_9BACI) ABC transporter ATP-binding protein {ECO:0000313|EMBL:ESU73130.1} KW=Complete proteome OX=1408282 OS=Geobacillus sp. MAS1. GN=T260_04400 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MRRMLQLKGIYKVFHEGTPDEKIALQNIHLTLRKGDFVTVIGSNGAGKSTLMNLISGVLF
PDEGTIWIDGQDVTMMPEYVRSRYIGRVFQDPMAGTAPNMTIEENLAMAYTRNQKRTLRR
GVTKKRRDDFRELLSTLHLGLENRLQAKVGLLSGGERQALSLLMATFTEPAILLLDEHTA
ALDPARAELITNLTKEIVERYRLTTLMVTHNMQQAIDLGNRLIMMDKGQIIFEVDENEKK
SLTVEKLLAEFQRIRGEQLASDRAVLS
Download sequence
Identical sequences Q5KYC3 V6VLC8
gi|56420563|ref|YP_147881.1| 235909.GK2028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]