SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V7D4M6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V7D4M6
Domain Number 1 Region: 11-263
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 1.96e-51
Family Aldo-keto reductases (NADP) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V7D4M6
Sequence length 270
Comment (tr|V7D4M6|V7D4M6_9PSED) Aldo/keto reductase {ECO:0000313|EMBL:ESW37287.1} KW=Complete proteome OX=1388762 OS=Pseudomonas taiwanensis SJ9. GN=O164_24790 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSLPTLHDFHRPLGSTGFKVSPLGLGTVKLGRDQGVKYPTGFTIPGDDEARLLLAQAREL
GINLIDTAPAYGRSEERLGPLLRGQRDEWVIVSKVGEEFDNGQSHFDFSAAHTRRSVERS
LRRLETDRIELVLVHSDGNDLAILEQQEVYQTLAELKQEGKILGFGLSGKTVAGGLKALE
QGDCAMVTYNLNEQAERPVLDYAAEHGKAILVKKALASGHICLAPGVDPVQASFELLFAH
PGVSSAIVGTINPLHLAHNVATVARILGQH
Download sequence
Identical sequences A0A059V3G4 A0A099N503 A0A1L5PXB2 F8FU14 V7D4M6 V9V8P8
2030578169 WP_013974470.1.23948 WP_013974470.1.28354 WP_013974470.1.35335 WP_013974470.1.35716 WP_013974470.1.41505 WP_013974470.1.56258 WP_013974470.1.59340 WP_013974470.1.65739 WP_013974470.1.7288 WP_013974470.1.80759 gi|568189658|ref|YP_008962342.1| gi|568184285|ref|YP_008956979.1| gi|339489657|ref|YP_004704185.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]