SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V7D5P6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V7D5P6
Domain Number 1 Region: 1-263
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.46e-84
Family Crotonase-like 0.0000549
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V7D5P6
Sequence length 263
Comment (tr|V7D5P6|V7D5P6_9PSED) Enoyl-CoA hydratase {ECO:0000313|EMBL:ESW36606.1} KW=Complete proteome OX=1388762 OS=Pseudomonas taiwanensis SJ9. GN=O164_28820 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MTFQHILFSIEDGVALLSLNRPEQLNSFNTAMHLEVREALKQVRQSSEARVLLLTAEGRG
FCAGQDLSDRNVAPGAEMPDLGESIDKFYNPLVRTLRDLPLPVVCAVNGVAAGAGANIPL
ACDLVLAARSASFIQAFCKIGLVPDSGGTWLLPRLVGMARAKALAMLGERLGAEQAQQWG
LIHRVVDDAALRDEALTLARQLATQPTYGLALIKRSLNASFDNGFDEQLELERDLQRLAG
RSEDYREGVSAFMNKRTPAFKGR
Download sequence
Identical sequences A0A099N146 A0A1L5PQY0 F8FUY8 V7D5P6 V9UZQ9
WP_013972608.1.23948 WP_013972608.1.28354 WP_013972608.1.36363 WP_013972608.1.56258 WP_013972608.1.59340 WP_013972608.1.65739 WP_013972608.1.7288 WP_013972608.1.80759 gi|568182246|ref|YP_008954862.1| gi|339487591|ref|YP_004702119.1| gi|568187624|ref|YP_008960230.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]