SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V7DDB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V7DDB3
Domain Number 1 Region: 60-198
Classification Level Classification E-value
Superfamily CBS-domain pair 8.59e-32
Family CBS-domain pair 0.004
Further Details:      
 
Domain Number 2 Region: 198-277
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.99e-22
Family CorC/HlyC domain-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V7DDB3
Sequence length 279
Comment (tr|V7DDB3|V7DDB3_9PSED) Magnesium transporter {ECO:0000313|EMBL:ESW40309.1} KW=Complete proteome OX=1388762 OS=Pseudomonas taiwanensis SJ9. GN=O164_07010 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSEDRSSNGQKSWLGKLTQAFAHEPKNRQQLLELLREAHQNKLLDSEALTIVEGAIQVAD
LQVRDIMVPRSQMISIKASQSPREFLPAVIDAAHSRYPVIGESHDDVLGILLAKDLLPLI
LKENGDSFNIKDLLRPATFVPESKRLNVLLREFRANHNHMAIVIDEYGGVAGLVTIEDVL
EQIVGDIEDEHDVEEDSYIKPLPSGDFLVKALTPIENFNEFFDSEFSDDEFDTVGGLVMS
AFGHLPKRNETTEIGPYKFRILNADSRRIHLLRLTPITR
Download sequence
Identical sequences A0A059V5G5 A0A099N685 A0A0C1KT36 A0A136QJB8 A0A1L5PWF4 F8G6P3 J8VEE8 L0FRD3 V7DDB3 V9V3G0 V9X3F1
gi|568189517|ref|YP_008962199.1| gi|568184144|ref|YP_008956836.1| WP_003257584.1.15314 WP_003257584.1.1643 WP_003257584.1.23948 WP_003257584.1.28354 WP_003257584.1.32670 WP_003257584.1.33515 WP_003257584.1.35335 WP_003257584.1.35716 WP_003257584.1.41505 WP_003257584.1.42658 WP_003257584.1.52768 WP_003257584.1.56258 WP_003257584.1.57632 WP_003257584.1.59340 WP_003257584.1.61620 WP_003257584.1.65739 WP_003257584.1.71677 WP_003257584.1.7288 WP_003257584.1.7435 WP_003257584.1.76210 WP_003257584.1.76710 WP_003257584.1.78427 WP_003257584.1.80759 WP_003257584.1.92076 WP_003257584.1.9402 WP_003257584.1.95946 WP_003257584.1.99927 gi|339489515|ref|YP_004704043.1| gi|431804608|ref|YP_007231511.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]