SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V9KAQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9KAQ5
Domain Number 1 Region: 701-848
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.23e-38
Family Regulator of G-protein signaling, RGS 0.0000952
Further Details:      
 
Domain Number 2 Region: 1038-1135
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.44e-29
Family Ras-binding domain, RBD 0.0011
Further Details:      
 
Domain Number 3 Region: 215-364
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-23
Family Phosphotyrosine-binding domain (PTB) 0.011
Further Details:      
 
Domain Number 4 Region: 13-98
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-20
Family PDZ domain 0.0065
Further Details:      
 
Domain Number 5 Region: 983-1052
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000227
Family First domain of FERM 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V9KAQ5
Sequence length 1221
Comment (tr|V9KAQ5|V9KAQ5_CALMI) Regulator of G-protein signaling 12-like protein {ECO:0000313|EMBL:AFO94793.1} OX=7868 OS=Callorhinchus milii (Ghost shark). GN= OC=Holocephali; Chimaeriformes; Callorhinchidae; Callorhinchus.
Sequence
MYRQADQVKRRLNPNAPIRMRNVDVARGRTGYGFTLSGQAPCVLSCILKGSPADYVGLRS
GDRILSVNDINVSKASHDDVVKLIGKCTGVLQLVIADSSNHSDTGSSDEELYFNEGKGGW
MNNKPKSKHFGLNRAEKVVADIQSGGIFNVLFENSKLPAKHSRNCLQQQRKTAETVSGFP
TRHGNTGTNHNSLSEEEVMKVLNDNSMFASGLESQDDFALDSNILNVGMIVGYLGSIELP
STSSNLENDSLQAIRGCMRRLRAEQKIHSLVLMKIMHDCIKLCNDKNAVLAVYPAEKLAF
TAVCPDDRRFFGLVTMQIADDNNFAKENEGGLRTSCHVFMVDPELCQHKIHQGIARRFDI
DCTPDTDTNGCLEFPPSSQPVLQFVSVLYKDLGESFESMRARAFLDGDVYAPDGQQNNST
GSNSDSGIGCYSQEEKSRRVLVVDLGTNPNKHASNGARGSAQNKGPIQTASQWNGCRPDL
ESKFHAPRLSDLAQNDYSLHNGNRHMGSSTRLDVPGTSAWSAFPSAKKADITGNAPCANP
KWLPLHIRKDWQYCSSSDQESYAESTDGLSSVNCGTLKQDLPPPMSKIQTEKYRVGSGFG
QPFRAVPQKDELTRKLFGVEKMFGIQQNSKKSKDKKVAKLSGILVGFPQASQRSSVRRSY
GRSKRFSITRSLDDLETAAVSDGELNGADLNNCNSDNSLNSNASLPSVQSCKKHTERRVA
SWAVSFERLLQDSVGIRFFSEFLKKEFSEENILFWQSCEYFGQIAQNDRKQLLYRAREIY
NNFLSNKAITPVNIDSQAQLADEIINAPHPNMFKEQQLQIFNLMKFDSYTRFLKSPLYQE
CMLAEVEGRSLPDPCLVPSSPASKHSASSDLSTPKKFSTKSKSGRLLLTELDDEDGNKKK
GAFFSWSRRSLGRPQKRKENSDSQGELSDSNGLSHYRRESLGSMSSSTCTESTSPGYHAN
NKQEKSDATRVLMPMTEKEKSAKHCIVNLPDGSSYTVAIQAGISIRELLTELSEQLHIQV
AAIDLFLVGADKPLVLDQDCITLNTREVRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEV
LRPVVAKYGLKLNELVARINGEDEVLDLGIPISNLDGMRVVLDVAEHSAGKDKQKSGGVK
PGPSTLGTRNHDVTEKEERNLGKPSSVKEKGDNGKSSKDGRSLKKEDLIERTEKKKQPKL
KLNEVEELFNLLTKAQRNRVD
Download sequence
Identical sequences V9KAQ5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]