SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V9UXL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9UXL3
Domain Number 1 Region: 3-368
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.34e-91
Family FMN-linked oxidoreductases 0.0000143
Further Details:      
 
Domain Number 2 Region: 346-650
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.53e-30
Family FAD-linked reductases, N-terminal domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V9UXL3
Sequence length 650
Comment (tr|V9UXL3|V9UXL3_9PSED) Oxidoreductase {ECO:0000313|EMBL:AHC87959.1} KW=Complete proteome OX=1435058 OS=Pseudomonas monteilii SB3101. GN=X970_11400 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MQTAFPHLFEALQIRGKRLKNRIMSTGHDTCLPTDNLVNDKLIAYQRARAAGGVGLIVLQ
VAGVHDSARYTSHVLMATDDACIDGYRQLAEACHEHGTVVLSQLFHPGREIMESADGLLA
VAYSASAVPNERFRVMPRALDQAMIDEIVQGYASAARRLHQAGLDGVEVVASHGYLPAQF
LNPRVNQRSDGYNGELEQRLRFLREVLAAVRAATDEQFIIGLRISADERDSQGLSEDESL
AAAVALQGQLDYLHIVAGTSASLGGAVHIVPPMAIQPAYLAREAGTFKQHLGIPLFVTGR
INQPQEAELILARGQADVCGMTRALICDPQMPNKTEHGQVEDVRACIACNQACIGHFHRG
LPISCIQRPETGRELQYEQLPPTTRPKRILVAGGGPAGMKAAAVAAARGHQVTLYEAGPQ
LGGQVLLAQLLPRRSEFGGASTNLQREMALAGVEVVRNTRVDRALVERERPDLVIAATGA
TPYWPAFERTGDLQVVDAWQILRSEAKPGRSVLVIDWRCDWIGPGIAERLVRDGHQVQLA
VNGTHCGESLPLYVRDQLAGELHRLGIPITPYARLYGCDDNTVYLQHTASGEPMIFEGID
TLVLCQGHQPEDRLATELAGLVEVRRIGDCLAPRTAEEAIHDGLTVAWAL
Download sequence
Identical sequences A0A059USF1 A0A099N0P5 F8FSF6 V7D487 V9UXL3
WP_013972469.1.23948 WP_013972469.1.28354 WP_013972469.1.35335 WP_013972469.1.56258 WP_013972469.1.7288 WP_013972469.1.80759 gi|568182052|ref|YP_008954660.1| gi|568187432|ref|YP_008960030.1| gi|339487446|ref|YP_004701974.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]